8OL9L

Anti-fixa fab in complex with human des-(gla-egf1) fixa
Total Genus 9

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
55
structure length
51
Chain Sequence
TCNIKNGRCEQFCKNSVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTS

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI1 (4-7)TIV1 (12-15)TIV2 (17-24)3H1 (8-11)S3 (32-35)S1 (15-17)S2 (25-27)S4 (40-43)TII2 (34-37)TII1 (29-32)TIV4 (48-51)TVIII2 (45-48)Updating...
connected with : NaN
molecule tags Blood clotting
source organism Homo sapiens
publication title Computational design of N-linked glycans for high throughput epitope profiling.
pubmed doi rcsb
molecule keywords Light chain of FIXa binding Fab
total genus 9
structure length 51
sequence length 55
ec nomenclature ec 3.4.21.22: coagulation factor IXa.
pdb deposition date 2023-03-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...