8ONWD

Crystal structure of the hetero-dimeric complex from archaeoglobus fulgidus prc1 and prc2 domains
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
MIGEITTFFGMRVFTDEGRYVGRVEDVILDQNTKSIRGLAISDYNKALIDSHAKGVIIPYRVVKAVGDIIIIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords PRC-barrel domain-containing protein
publication title Crystal structure of the hetero-dimeric complex from Archaeoglobus fulgidus PRC1 and PRC2 domains
rcsb
source organism Archaeoglobus fulgidus
total genus 16
structure length 75
sequence length 75
chains with identical sequence F
ec nomenclature
pdb deposition date 2023-04-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...