8ONZLR

Chaetomium thermophilum methionine aminopeptidase 2 at the 80s ribosome
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
153
Chain Sequence
VNLRTQKRLAASVLGCGEGKVWLDPNEVSEISNANSRQSIRKLVADGLIIKKPVTMHSRSRARELNLARRIGRHRGFGKRKGTADARMPQQVLWMRRQRVLRRLLVKYRASGKIDKHLYHELYHLAKGNTFKHKRALVEHIHRAKAEKARERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Ribosomal protein L19
publication title Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
pubmed doi rcsb
source organism Thermochaetoides thermophila dsm 1495
total genus 48
structure length 153
sequence length 153
ec nomenclature ec ?:
pdb deposition date 2023-04-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...