8OR4H

Partially dissociated cand1-cul1-rbx1-skp1-skp2-cks1-cdk2
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
80
structure length
49
Chain Sequence
TLWYRAPEIYSTAVDIWSSEIDQLFRIFRTVWPGVTSMPDYKPSFPKWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic insights into the CAND1-mediated SCF substrate receptor exchange.
pubmed doi rcsb
molecule tags Ligase
source organism Homo sapiens
molecule keywords Cullin-1
total genus 3
structure length 49
sequence length 80
ec nomenclature ec 2.7.11.22: cyclin-dependent kinase.
pdb deposition date 2023-04-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...