8OUNA

Arf gtpase from the asgard gerdarchaea : gerdarfr1 bound to gdp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
181
structure length
181
Chain Sequence
LLSFLQRLFRQKKQFKIAVVGLDSAGKTTMLNFLRFEKNIETLPTIGVNVEVLKRQNVNLSIFDLGGQLHFRNLWGTLMKGSSAIIFVMDSADRYRIEEAKNELWKVLLDPNYPDAPLLIVANKQDKEGAMSIQEIISVCGLDNPEKLGNRSWHIQPTVATTGQGVEEAIKWIVMELDKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords GTP-binding protein
publication title Arf Family GTPases are present in Asgard archaea
rcsb
source organism Asgard group archaeon
total genus 55
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-04-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...