8OV9A

Crystal structure of ene-reductase 1 from black poplar mushroom
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
342
structure length
342
Chain Sequence
APVTNGRIIFNSIPTGFPVPGETTIYDTTETIDLDTAPLDGGFLLKTLELSVDPYMRGGMRAPEKKSYSAPFTLGQPLRGYGVGVVLRSENPQVKAGDHLYGFFEHTHYSIRKDLTGLQAIENAYNLPWSVFIGVIGMPGKTAYMAWKEYAHPKQGETVFVSTGAGPVGSFVIQLAKADGLKVIASAGSEEKVQFMKEVGADVAFNYKTTNTAEVLEKEGPIDIYWDNVGGETLEAALNAANVNARFIECGMISGYNSGGAPVRNIFHVIGKSITMTGFIVSRIEPKYSAEFYKEVPAKVASGELKYREHVYNGLEKLGDVILAVQKGENKAKAVVHVADDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Shifting the substrate scope of an ene/yne-reductase by loop engineering
rcsb
molecule keywords Ene-reductase 1
molecule tags Oxidoreductase
source organism Cyclocybe aegerita
total genus 110
structure length 342
sequence length 342
ec nomenclature
pdb deposition date 2023-04-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...