8OWPA

Crystal structure of mycobacterium smegmatis coab in complex with ctp and 2-(1-(4-hydroxyphenyl)-5-phenyl-1h-indol-3-yl)-2-oxoacetic acid
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
229
structure length
214
Chain Sequence
HHDMAGVKALVTAGGTREPLDPVRFIGNRSSGKQGYAVARVLAQRGADVTLIAGNTAGLIDPAGVEMVHIGSATQLRDAVSKHAPDANVLVMAAAVADFRPAHVAAAKIKEPSSIDLVRNDDVLAGAVRARADGQLPNMRAIVGFAAETGDANGDVLFHARAKLERKGCDLLVVNANDGWLLSADGTESALEHGSKTLMATRIVDSIAAFLKSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Development of new inhibitors against M. tuberculosis CoaBC using a fragment based approach.
rcsb
molecule tags Ligase
source organism Mycolicibacterium smegmatis mc2 155
molecule keywords Coenzyme A biosynthesis bifunctional protein CoaBC
total genus 63
structure length 214
sequence length 229
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2023-04-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...