8P1RA

Bifidobacterium asteroides alpha-l-fucosidase (tt1819) catalytic mutant.
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
341
structure length
341
Chain Sequence
SDTVEWFKQAKYGMMIHWGLYSLLGGEYQGKSSSNYAEWVQSKLQIPNKEYERLTQAFNPIYFDADAIIDLAKRCGMQYLVVTTKHHDGFAMYRSLVDPYNVYDATPFHRDVIGELSLACRKAGLRFGLYYSQDLDWHEPDGGGYLSNDIETAGTTWDNSWDFTGEKNYDRAFKHKIMPQIEEIMSNYGEISVAWFNVPMTLSDEQSQTIYDTVKRLQPDCLINSRLGNGRYDYVSLGDNEIPEDSDASDKATSDGNVDYNSIEGFKPSKLGLYETAGTINDSWGFAYHDQNWKSPQTIHDYKAHLNKYGINYLLNVGLDGLGRVPMAAEQALLGARALEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Bifidobacterium asteroides alpha-L-fucosidase (TT1819) catalytic mutant
publication title Exploring sequence, structure and function of microbial fucosidases from glycoside hydrolase GH29 family
rcsb
source organism Bifidobacterium asteroides
total genus 135
structure length 341
sequence length 341
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2023-05-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...