8P3ZE

Homomeric glua2 flip r/g-edited q/r-edited f231a mutant in tandem with tarp gamma-2, desensitized conformation 2
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
206
structure length
177
Chain Sequence
DRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTEEVMTHSGLWRTCCLEGNFKGLCKQIDHFPDTAEYFLRAVRASSIFPILSVILLFMGGLCIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGSYSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor 2
publication title Structural mobility tunes signalling of the GluA1 AMPA glutamate receptor.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 65
structure length 177
sequence length 206
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2023-05-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...