8P4QA

Structure of the imp dehydrogenase related protein guab3 from synechocystis pcc 6803
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
390
structure length
388
Chain Sequence
GSHMNITIGRGKTARRAYGIDEIALVPGVRTLDPALADTRWKVGAIEREIPIIASAMDGVVDSRMAVLLSELGALGVVNLEGIQTRYEDPNPILDRIASVGKTEFVGLMQELYAEPIKPELITKRIQEIQAAGGIAAVSLTPVGASKYASTVAEAGADLLFIQATVVSTAHLSPVESLDLVKLCQEMPMPVVLGNCVTYEVSLELMRAGAAAVLVGIGPGAACTSRGVLGVGVPQPTAIADCAAARDDYLQETGRYVPVIADGGIITGGDICKCIACGADAVMIGSPIARAAEAPGRGFHWGMATPSPVLPRGTRINVGTTGTIREILVGPAKLDDGTHNLLGAIKTSMGTLGAKDMKEMQQVDVVIAPSLLTEGKVYQKAQQLGMGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Biosynthetic protein
molecule keywords IMP dehydrogenase subunit
publication title GuaB3, an overlooked enzyme in cyanobacteria's toolbox that sheds light on IMP dehydrogenase evolution.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 125
structure length 388
sequence length 390
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec ?:
pdb deposition date 2023-05-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...