8P4XA

Fad_ox bound dark state structure of pdlcry
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
526
structure length
526
Chain Sequence
EHVSLHWFRHGLRLHDNPALLKSLEGAKEFYALFIWDGEVAGTKLVSYPRMKFLLECLKDLDDSLKKHGGRLYVVKGPSDVVIKQLIEEWGVTRVTCEIDPEPIWQPRDKAVKDLCATKGVKWFDYNSHLLWDPKAVCDANGGRPPHTYKLFCQVTDLLGKPETPHPDPDFSHVQMPVSDDFDDKFGLPTLKELGCEPECEEQEKPFNKWQGGETGALELLETRLMIERTAYKAGYIMPNQYIPDLVGPPRSMSPHLRFGALSIRKFYWDLHNNYAEVCGGEWLGALTAQLVWREYFYCMSYGNPSFDKMEGNPICLQIPWYKDEEALEKWKQGQTGFPWIDACMRQLRYEGWMHHVGRHAVACFLTRGDLWISWVDGLEAFYKYMLDGDWSVCAGNWMWVSSSAFENCLQCPQCFSPVLYGMRMDPTGEFTRRYVPQLKNMPLKYLFQPWKAPKEVQEKAGCVIGEDYPSPMVDHKEASSKCRRMMEDVKSIIKDPEVWHCTPSDTNEVRKFCWLPEHMTADQPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords Putative light-receptive cryptochrome (Fragment)
publication title A marine cryptochrome with an inverse photo-oligomerization mechanism
doi rcsb
source organism Platynereis dumerilii
total genus 131
structure length 526
sequence length 526
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-05-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...