8P60KR0

Spraguea lophii ribosome dimer
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
164
structure length
164
Chain Sequence
MKLPRVKELSADILKCGVRRIYLDTFEPSKLSAATSRDDIRKLIKDGLIVRKAQKIHSRYHANKLMREKEKGRHSGPGKVKGSKNARMPEKDKWIKRIRDLRNTLKELRDKGEITKTEHKMYYQKTKGNGYKNSAALMGAIKQKHDDERRMKEIEEQAKALKIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spraguea lophii ribosome
rcsb
molecule keywords RNA 28S
molecule tags Ribosome
total genus 52
structure length 164
sequence length 164
chains with identical sequence LR0
ec nomenclature
pdb deposition date 2023-05-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...