8P6GB

Crystal structure of the improved version of the genetically encoded green calcium indicator ytnc2-5
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
300
structure length
244
Chain Sequence
VSKGEELFTGVVPILVEMVGDVNGHRFSVSGEGEGIATYGMLTLKLICTTGELPVPWPTLVTTLMACFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGYYKTRAEVKFEGDTLVNRIELKGFDFREDGNILGHKLGYNFDLSDFGEFLKMVENVRGINSHSVYITADKQKNGVKAHFEIRHNLEDGSVQLADHYQQNTPIGDGPVLLPDNHYLRHQSALSKDPNEKRDHMVLQEFVTAAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title YTnC2, an improved genetically encoded green calcium indicator based on toadfish troponin C.
pubmed doi rcsb
molecule keywords Genetically Encoded Green Calcium Indicator YTnC2-5 based on Troponin C from toadfish
molecule tags Fluorescent protein
source organism Synthetic construct
total genus 65
structure length 244
sequence length 300
chains with identical sequence D
ec nomenclature
pdb deposition date 2023-05-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...