8P6IH

Crystal structure of the 139h2 fab fragment bound to muc1 peptide epitope
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
210
Chain Sequence
QVQLQQSGAELVKPGASVKLSCKASGYTFTNYYMYWVLQRPGQGLEWIGEINPSNGGTTFNEKFKNKATLTVDKSSSTAYMQLNSLTSEDSAVYYCTRSRYGNYVNYGMDYWGQGTSVTVSSASTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Mucin-1
publication title Reverse-engineering the anti-MUC1 antibody 139H2 by mass spectrometry-based de novo sequencing.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 210
sequence length 222
chains with identical sequence h
ec nomenclature
pdb deposition date 2023-05-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...