8P6JBBB

Structure of the hypervariable region of streptococcus pyogenes m3 protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
104
structure length
104
Chain Sequence
DARSVNGEFPRHVKLKNEIENLLDQVTQLYTKHNSNYQQYNAQAGRLDLRQKAEYLKGLNDWAERLLQELNGEDVKKVLGKVAFEKDDLEKEVKELKEKIDKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for collagen recognition by the Streptococcus pyogenes M3 protein
rcsb
molecule tags Protein binding
source organism Streptococcus pyogenes serotype m3
molecule keywords M protein
total genus 46
structure length 104
sequence length 104
chains with identical sequence CCC, FFF, GGG
ec nomenclature
pdb deposition date 2023-05-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...