8P7GA

Structural characterization of phox2b and its dna interactions shed lights into the molecular basis of the + 7ala variant pathogenicity in cchs
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
63
structure length
63
Chain Sequence
ASQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of PHOX2B and its DNA interaction shed lights into the molecular basis of the + 7Ala variant pathogenicity in CCHS
doi rcsb
molecule keywords Paired mesoderm homeobox protein 2B
molecule tags Protein binding
source organism Homo sapiens
total genus 22
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2023-05-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...