8PAEAA

Structure of the ectodomain of atypical porcine pestivirus e2 at 1.2a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
149
Chain Sequence
GSCHIRQDYYNIQLVVEEKTGVEKRSIMGKWSVITREGREPKLMEQINIVSNNSLSETYCYNRLNTSSWGRQPARQRGCGQTVPYWPGDNVLEEQYYSTGYWVNATGGCQLREGVWLSRKGNVQCQRNGSSLILQLAITMEIPCDPVET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Genome polyprotein
publication title Structural comparison of typical and atypical E2 pestivirus glycoproteins.
pubmed doi rcsb
source organism Atypical porcine pestivirus
total genus 38
structure length 149
sequence length 154
ec nomenclature ec 3.4.21.113: pestivirus NS3 polyprotein peptidase.
pdb deposition date 2023-06-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...