8PEIA

Crystal structure of the biphotochromic fluorescent protein saasoti (c21n/v127t variant) in its green on-state
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
215
Chain Sequence
KQYIPDDMELIFHMDGNVNGHYFTIVATGKAKPYEGKQNLKATVTKGAPLPFSTDILSTVMNRCIVHYPPGIPDYFKQSFPEGYSWERTFAFEDGGFCTVSADIKLKDNCFIHTSMFHGTNFPADGPVMQRKTIQWEKSIEKMTVSDGIVKGDITMFLLLEGGGKYRCQFHTSYKAKKVVEMPQSHYVEHSIERTNDDGTQFELNEHAVARLNEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Fluorescent protein
molecule keywords C21N/V127T form of the biphotochromic fluorescent protein SAASoti
publication title Crystal structure of the biphotochromic fluorescent protein C21N/V127T SAASoti in its green on-state
rcsb
source organism Stylocoeniella armata
total genus 62
structure length 215
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-06-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...