8PFCA

Crystal structure of binary complex between aster yellows witches'-broom phytoplasma effector sap05 and the zinc finger domain of spl5 from arabidopsis thaliana
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
EEFVGDMRIVNVNLSNIDILKKHETFKKYFDFTLTGPRYNGNIAEFAMIWKIKNPPLNLLGVFFDDGTRDDEDDKYILEELKQIGNGAKNMYIFWQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bimodular architecture of bacterial effector SAP05 drives ubiquitin-independent targeted protein degradation
doi rcsb
molecule tags Protein binding
source organism Aster yellows witches'-broom phytoplasma aywb
molecule keywords Sequence-variable mosaic (SVM) signal sequence domain-containing protein
total genus 22
structure length 97
sequence length 97
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2023-06-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...