8PK3G

Cryoem reconstruction of hemagglutinin hk68 of influenza a virus bound to an affimer reagent
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
87
structure length
87
Chain Sequence
SLEIEELARFAVDEHNKKENALLEFVRVVKAKEQFNYDQWQDYTMYYLTLEAKDGGKKKLYEAKVWVKFVDSAFETENFKELQEFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antiviral protein
molecule keywords Hemagglutinin HA1 chain
publication title Exploiting the Affimer platform against influenza A virus
rcsb
source organism Influenza a virus
total genus 9
structure length 87
sequence length 87
chains with identical sequence H, I
ec nomenclature
pdb deposition date 2023-06-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...