8POHC

Influenza a/h7n9 polymerase symmetric dimer bound to the promoter (pa k289a/c489r)
Total Genus 24

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
207
structure length
119
Chain Sequence
NPALRMKWMMAMKYPITADKRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRNGPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVYIEVLHLTQGTCWEQMYTPGG

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
source organism Influenza a virus (a/zhejiang/dtid-zju01/2013(h7n9))
publication title The host RNA polymerase II C-terminal domain is the anchor for replication of the influenza virus genome.
pubmed doi rcsb
molecule keywords Polymerase acidic protein
total genus 24
structure length 119
sequence length 207
chains with identical sequence G
ec nomenclature ec ?:
pdb deposition date 2023-07-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.