8PV5Lf

Chaetomium thermophilum pre-60s state 8 - pre-5s rotation without foot - composite structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
108
structure length
108
Chain Sequence
PSEAGHRLYVKGRHLSYQRGRRNTHPKTSLIKIEGVDDTAAANFYLGKRVAYVYRAQKEVRGTKIRVIWGKITRPHGNSGVVRAKFTHPLPARSFGASVRIMLYPSSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
pubmed doi rcsb
molecule tags Ribosome
source organism Thermochaetoides thermophila dsm 1495
molecule keywords 26S rRNA
total genus 16
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2023-07-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...