8PV5Lg

Chaetomium thermophilum pre-60s state 8 - pre-5s rotation without foot - composite structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
APTRVTYRRRNPYNTTSNRTRVIKTPGGQLRVLHIKKRGTAPKCGDCGIKLPGIPALRPREYATISKPKKTVQRAYGGSRCGNCVRDRIIRAFLIEEQKIVKKVLKEQSQAEKKASKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
pubmed doi rcsb
molecule tags Ribosome
source organism Thermochaetoides thermophila dsm 1495
molecule keywords 26S rRNA
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2023-07-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...