8PV8LN

Chaetomium thermophilum pre-60s state 4 - post-5s rotation with rix1 complex without foot - composite structure
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
202
structure length
202
Chain Sequence
GALKYLEELSKKKQSDVVRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRCSNLRVLNSYWVNQDSTYKYYEVILVDPNHKAIRRDPRINWICNPVHKHRECRGLTSTGKKSRGLNKGHRFNKTRAGRRKTWKRHNTLSLWRYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 26S rRNA
publication title Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
pubmed doi rcsb
source organism Thermochaetoides thermophila dsm 1495
total genus 53
structure length 202
sequence length 202
ec nomenclature ec ?:
pdb deposition date 2023-07-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...