8PVTA

Manganese-dependent transcriptional repressor dr2539 complexed with cadmium (sad 7 kev)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
139
structure length
134
Chain Sequence
TLSPSAEDYLKHLYGLGQSGKVSTQALAAALGVAPASVTGMLRKLTEQGLVSGARLTAEGERVALEVLRHHRLLELFLHRALGVPLDEVHDEAEALEHALSERLEARIAAWLGDPTHDPHGDPIPTLEGELPAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Metal ion activation and DNA recognition by the Deinococcus radiodurans manganese sensor DR2539.
pubmed doi rcsb
molecule tags Dna binding protein
source organism Deinococcus radiodurans
molecule keywords Iron dependent repressor, putative
total genus 40
structure length 134
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-07-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...