8Q29A

Ttx122a - a domain of unknown function from the teredinibacter turnerae protein tertu_3803
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
242
structure length
242
Chain Sequence
SLINFTDGFESTGVNQQPSGWGNFVGWQSNNPNNNIGQSVYALVDNTRAFTGNNSVHFKGGAAPAQIVRTLPAGLDKVYLKAMVYMSKKLGNEAGDNHEHIFGVRGNVAQADNEVRFGQIKGHVGTNEMPSDDISPPQSQWYSGPEIAADTWHCVVVEMLGGNRPYHQLHAYLDNQLIHSIDSISDWNNGGVNGNTQWLDGKLNYAFFGWHSFSNNNADVWMDDIEISDQPISCDSRELEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords Gluconolactonase domain protein
publication title Structural dissection of two redox proteins from the shipworm symbiont Teredinibacter turnerae
doi rcsb
source organism Teredinibacter turnerae
total genus 64
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature ec ?:
pdb deposition date 2023-08-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...