8Q2AA

Ttx122b - a domain of unknown function from the teredinibacter turnerae protein tertu_2913
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
234
structure length
234
Chain Sequence
SGFFVSDDFESSSVSQQPAGWDNFVGWQSNNPNNNSGQAVYAVVDNSRAYSGSQSVHFKGGAAPAQIVKALPQGLDRVYLKAMVYMSKKLGNEANDNHEHIMGVRANASGADNEIRFGQIKGHIGTNEVPSDDIAPPQSQWYSGPEITANDWHCVVVEMLAGDLAYHQLNAYVDGELLHSIDAANDWNNGGVNGNAHWLDGKFNYAFFGWHSFSNNDADVWMDDIEMSDAPLTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural dissection of two redox proteins from the shipworm symbiont Teredinibacter turnerae
doi rcsb
molecule keywords Putative lipoprotein
molecule tags Unknown function
source organism Teredinibacter turnerae
total genus 55
structure length 234
sequence length 234
chains with identical sequence B, C
ec nomenclature ec ?:
pdb deposition date 2023-08-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...