8Q3KJ

The open state of the asfv apo-rna polymerase
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
MLIPVVCFTCGFPIGTYAAIFDKARTEYIKTKMDGTLPQNIPLDASLQIELKDLITALGIPMRVCCRTHLITTLDYRKYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of the fully recombinant RNA polymerase from African Swine Fever Virus
rcsb
molecule tags Transcription
source organism African swine fever virus ba71v
molecule keywords DNA-directed RNA polymerase RPB1 homolog
total genus 19
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2023-08-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...