8Q7EA

Structure of cul9-rbx1 ubiquitin e3 ligase complex - hexameric assembly
Total Genus 251
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
251
sequence length
1849
structure length
947
Chain Sequence
LMVPLRLQAYPEELIRQRHDGHPEYLIRWSVLKCEHILMWLSAPEVYANCPGLLDEVAMGEMEADVQALVRRAARQLAESGTPSLTAAVLHTIHVLSAYASIGPLTGVFRETGALDLLMHMLCNPEPQIRRSAGKMLQALAAHDAGSRAHVLLSLSQQHMDFDSRYTLLELFAETTSSEEHCMAFEGIHLPQIPGKLLFSLVKRYLCVTSLLDQLNSRGQRELEFSMAVGNLISELVRSMGWARPTRSIFQPLYPLPYLQPTQAEWWELLFFIKKLDLCEQQPIFQNLWKNLGEISVSVEMAESLLQVLSSRFEGSTLNDLLNSQIYTKYLSVLRVITRLLDFPEAMVLPWHEVLEPCLNCLSDSEIVQELTCFLHRLASHKDYAVVLCCLGAKEILSKVLDKHGCELRDLVTECEKYAQLYSNLTSSILAGCIQMVLGQIEDHRRTHQPINIPFFDVFLRHLCQFWPLFREQLCRRTCLFYTIRAQAWSRDIAEDHRRLLQLCPRLNRVLRHEQNFADRFLPDDEAAQALGKTCWEALVSPLVQNITSPDAEGVSALGWLLDQYLEQRETSRNPLSRAASFASRVRRLCHLLVHVEPPSSSLRNITQCWLSVVQEQVSRFLAAAWRAPDFVPRYCKLYEHLQRAGSELFGPRAAFMLALRSGFSGALLQQSFLTAAHMSEQFARYIDQQIQGGLIGGAPGVEMLGQLQRHLEPIMVLSGLELATTFEHFYQHYMADRLLSFSWLEGAVLEQIGLCFPNRLPQLMLQSLSTSEELQRQFHLFQLQRLDKLFLEQEDEPSPAISILVLSPRCWPVSPLCYLYHPRKCLPTEFCDALDRFSSFYSQSQNHRRLQWTWLGRAELQFGKQILHVSTVQMWLLLKFNQTEEVSVETLLKDSDLSPELLLQALVPLTSGNGPLTLHEGVLRLHEPGSGEALWLIPPQAYLNVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Noncanonical assembly, neddylation and chimeric cullin RING/RBR ubiquitylation by the 1.8 MDa CUL9 E3 ligase complex
doi rcsb
molecule tags Ligase
source organism Homo sapiens
molecule keywords Cullin-9
total genus 251
structure length 947
sequence length 1849
chains with identical sequence B, E, F, I, J
ec nomenclature
pdb deposition date 2023-08-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...