8Q7RC

Ubiquitin ligation to substrate by a cullin-ring e3 ligase & cdc34: nedd8-cul2-rbx1-elob/c-fem1c with trapped ube2r2~donor ub-sil1 peptide
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
181
structure length
162
Chain Sequence
TSSQKALMLELKSLQEEPVEGFRITLVLYNWEVAIFGPPNTLYEGGYFKAHIKFPYPYSPPTFRFLTKMWHPNIYENGDVCISILHPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKDKEYAEIIRKQVSATKAEAEKDGVKVPTTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cullin-RING ligases target substrates with geometrically optimized catalytic partners
doi rcsb
molecule tags Ligase
source organism Homo sapiens
molecule keywords Cullin-2
total genus 26
structure length 162
sequence length 181
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
pdb deposition date 2023-08-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...