8QAOA

Crystal structure of tp901-1 ci-ntd89 repressor n-terminal domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
84
structure length
83
Chain Sequence
MQTDTSNRLKQIMAERNLKQVDILNLSIPFQKKFGIKLSKSTLSQYVNSVQSPDQNRIYLLAKTLGVSEAWLMGFDVPMVESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords CI
publication title CI:Mor interactions in the lysogeny switches of Lactococcus lactis TP901-1 and Staphylococcus aureus phi 13 bacteriophages
doi rcsb
source organism Lactococcus phage tp901-1
total genus 31
structure length 83
sequence length 84
ec nomenclature ec ?:
pdb deposition date 2023-08-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...