8QBIA

Anti in closed state
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
375
structure length
375
Chain Sequence
PNRISPELLATCGYFMPRIFFLNSQYAPQVHWGDVVAALSHFPAGNLDLSSEEFWYEWMINWSKVGDSYINIANSAKSEVSHVRALRSAAACYHWAEFMYFSDRSRKIQLREYIRSCFLSSIKYSDLLVDHQYIVVDKFHMPFFLIFPKGYKEEENHPLPCVILSNGLDSMTEIEILSLAEFFLGKNMAVAIFDGPGQGINLGKSPIAIDMELYVSSIVKLLEDDARINSNLLCFLGISFGGYFALRVAQRIGDKFCCIVNLSGGPEIAEFDKLPRRLKEDFQFAFMQDNSHMQSIFDEIKLDISLPCKTKVFTVHGELDDIFQIDKVKKLDQLWGDNHQLLCYESEAHVCLNKINEYMIQVSDWVSEQFWLNGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Photorhabdus luminescens subsp. laumondii TTO1 complete genome segment 15/17
publication title Polyketide trimming shapes dihydroxynaphthalene-melanin and anthraquinone pigments
doi rcsb
source organism Photorhabdus laumondii subsp. laumondii tto1
total genus 140
structure length 375
sequence length 375
ec nomenclature ec ?:
pdb deposition date 2023-08-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...