8QCWA

The crystal structure of the truncated form of lotus japonicus kinase 1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
364
structure length
357
Chain Sequence
NEKDIEASIVSGNGTETGQIITTAQPKQTISYMAERVVGTGSFGVVFQAKCLETGEAVAIKKVLQDKRYKNRELQVMRTVDHPNIVKLKHCFFSTTDKDELYLNLVLEFVPETVYKVSKQYIRVHQHMPIIYVQLYIYQICRALNYLHQVIGVCHRDIKPQNLLVNPQTHQLKICDFGSAKMLVPGEPNISICSRYYRAPELIFGATEYTTAIDMWSVGCVLAELLLGHPLFPGESGVDQLVEIIKVLGTPTREEIRCMNPHYNEFKFPQIKAHPWHKVFYKRMPPEAVDLVSRLLQYSPNLRCTALAACAHPFFNDLRDPNASLPNGQPLPPLFNFTPEELAHAPDELRLRLIPEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biochemical and Structural Studies of LjSK1, a Lotus japonicus GSK3 beta /SHAGGY-like Kinase, Reveal Its Functional Role.
pubmed doi rcsb
molecule keywords non-specific serine/threonine protein kinase
molecule tags Transferase
source organism Lotus japonicus
total genus 93
structure length 357
sequence length 364
ec nomenclature ec 2.7.11.1: non-specific serine/threonine protein kinase.
pdb deposition date 2023-08-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...