8QD4A

Ayg1p active site converted to tetrahedral sulfonate ester
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
398
structure length
398
Chain Sequence
RWILGDKFDTVFPHKGSLKVLWESRWKFACSKSVYPFHDGSIEDFEPIFNHLISKNINDAASDEYTQAFLPTASALEEKAAQALQAGKHEEASNLLCRAAVVYRISRFPYVDITKPNSIKRVAFERQKQAYLKATSLWTQPIREVTVPHTYRTGNDGAHIPIYIRTPAGADQSNPVPIVLIMTGLDGYRPDNSQRTHEILARGWAAVVAEIPGTADCPADPADPASPDRLWDSVLSYLDQRPELNTAKMVVWGLSAGGYYAIRAAHTHRDRLLGAIAHGPGCHYYLDPEWLAKVNDHEYPFEITAAWATKHGYKTVEEFVAGAQKKFSLVETGIVDQPSCRLLLLNGVDDGVVPIEDCLVLFEHGSPKEGRFYKGLPHMGYPNSLPVSYEWLEQVLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Polyketide trimming shapes dihydroxynaphthalene-melanin and anthraquinone pigments
doi rcsb
molecule tags Lyase
source organism Aspergillus fumigatus
molecule keywords Pigment biosynthesis protein yellowish-green 1
total genus 152
structure length 398
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec ?:
pdb deposition date 2023-08-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...