8QDHA

Engineered lmrr carrying a cyclic boronate ester formed between tris and p-boronophenylalanine at position 89
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
107
structure length
106
Chain Sequence
PKEHLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYRLTEIGHENRLLEESWSRVDKIIENLEANKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Boron catalysis in a designed enzyme
rcsb
molecule keywords Transcriptional regulator, PadR-like family
molecule tags Transcription
source organism Lactococcus cremoris subsp. cremoris mg1363
total genus 36
structure length 106
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-08-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...