8QKEA

Pvsub1 catalytic domain in complex with peptidomimetic inhibitor (mh-13)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
341
structure length
333
Chain Sequence
YKFNDEYRNLQWGLDLARLDETQDLINANRVSVTKICVIDSGIDYNHPDLRNNIDVNVKELHGRKGVDDDSNGVVDDVYGANFVSNSGDPMDDNYHGTHVSGIISAVGNNGIGIVGVDGHSKLVICKALDQHKLGRLGDMFKCIDYCISRQAHMISGSFSFDEYSNIFSASVEHLRSLGILFFVSASNCAHAKCDLAVNHRYPPILSKTHNNVIAVANLKRDLDESYSLSVNSFYSNIYCQLAAPGTNIYSTTPMNNYRKLNGTSMASPHVAAIASIVRSINPNLTYLQIVEILRNAIVKLPSLTERVSWGGYVDILRAVNLAIDSKAAPYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights from structure-activity relationships and the binding mode of peptidic alpha-ketoamide inhibitors of the malaria drug target subtilisin-like SUB1
rcsb
molecule keywords subtilisin
molecule tags Hydrolase
source organism Plasmodium vivax
total genus 129
structure length 333
sequence length 341
chains with identical sequence B
ec nomenclature ec 3.4.21.62: subtilisin.
pdb deposition date 2023-09-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...