8QKGA

Pvsub1 catalytic domain in complex with peptidomimetic inhibitor (mam-125)
Total Genus 126

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
341
structure length
332
Chain Sequence
YKFNDEYRNLQWGLDLARLDETQDLINANRVSVTKICVIDSGIDYNHPDLRNNIDVNVKELHGRKGVDDDSNGVVDDVYGANFVSNSGDPMDDNYHGTHVSGIISAVGNNGIGIVGVDGHSKLVICKALDQHKLGRLGDMFKCIDYCISRQAHMISGSFSFDEYSNIFSASVEHLRSLGILFFVSASNCAAKCDLAVNHRYPPILSKTHNNVIAVANLKRDLDESYSLSVNSFYSNIYCQLAAPGTNIYSTTPMNNYRKLNGTSMASPHVAAIASIVRSINPNLTYLQIVEILRNAIVKLPSLTERVSWGGYVDILRAVNLAIDSKAAPYIK
5010015020025030030025020015010050
020406080100120Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
source organism Plasmodium vivax
publication title Insights from structure-activity relationships and the binding mode of peptidic alpha-ketoamide inhibitors of the malaria drug target subtilisin-like SUB1
rcsb
molecule keywords subtilisin
total genus 126
structure length 332
sequence length 341
chains with identical sequence B
ec nomenclature ec 3.4.21.62: subtilisin.
pdb deposition date 2023-09-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.