8QNNA

Crystal structure of a class a beta-lactamase from nocardia cyriacigeorgica
Total Genus 86

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
259
structure length
259
Chain Sequence
ADPRFAALETTAGARLGVFAVNTGSERTVAHRADERFPMASTFKGLACGALLREHPLSTGYFDQVIHYSAEELVDYSPVTETRVESGMTVAELCHAAITASDNTAGNQLLKLLGGPQGFTAFLRSLGDDTSRLDRWETELNTAIPGDERDTTTPAALAADYRALVVGDVLGEPERAQLTAWLVANTTGDTRIRAGLPEDWTVGDKTGSPAYGSALDVAVTWPSGRAPIVIAVLSTKSEQDAEPDNRLVADATRTVVDVL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
source organism Nocardia cyriacigeorgica
publication title Biochemical and structural characterization of a class A beta-lactamase from Nocardia cyriacigeorgica.
pubmed doi rcsb
molecule keywords Beta-lactamase
total genus 86
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2023-09-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.