8QVUA

Crystal structure of ligand acbi3 in complex with kras g12d c118s gdp and pvhl:elonginc:elonginb complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
166
structure length
155
Chain Sequence
TEYKLVVVGADGVGKSALTIQLIQNHFVDEDPTIEDSYRKQDGETDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting cancer with small molecule pan-KRAS degraders
doi rcsb
molecule tags Gene regulation
source organism Homo sapiens
molecule keywords Elongin-B
total genus 36
structure length 155
sequence length 166
chains with identical sequence E
ec nomenclature ec 3.6.5.2: small monomeric GTPase.
pdb deposition date 2023-10-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...