8QX7A

Apo-c-terminal domain homolog of the orange carotenoid protein from anabaena at a resolution of 1.95 angstroms
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
124
structure length
124
Chain Sequence
NIQIKSIAGITEPTILQYFATLNAGEFAATAALFAVDGVMYPPFESGIVGPDAIAAYLQQEAQGIKAEPQQGLAETSEDGHTQVQVSGKAQTSWCGVNVLWLFTLNQEKQIIHTQIKLLASPQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into energy quenching mechanisms and carotenoid uptake by Orange carotenoid protein homologs: HCP4 and CTDH.
pubmed doi rcsb
molecule keywords All4940 protein
molecule tags Photosynthesis
source organism Cyanobacteriota
total genus 27
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-10-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...