8QXBA

Tdp-43 amyloid fibrils: morphology-2
Total Genus 0

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
45
structure length
45
Chain Sequence
GSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSG

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein fibril
source organism Homo sapiens
publication title Cryo-EM observation of the amyloid key structure of polymorphic TDP-43 amyloid fibrils.
pubmed doi rcsb
molecule keywords TAR DNA-binding protein 43
structure length 45
sequence length 45
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature ec ?:
pdb deposition date 2023-10-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.