8QZRA

Sars-cov-2 delta rbd complexed with ba.4/5-9 fab
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
215
structure length
165
Chain Sequence
VQLVQSGPEVKKPGASVKVSCKASGDTFINSFFHWVRQAPGQGLEWMGIINPSGVSTTYAQKFQGRVTMTRDTSTTTFYMELSSLRSADTAVYYCARENGGNSGDFDYWGQGALVTVSSASTKGPKDYFPEPVTVSWNSGHTFPAVLQSSGLYSNHKPSNTKVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Emerging variants develop total escape from the potent monoclonal antibodies induced by BA.4/5 infection
rcsb
molecule tags Viral protein
source organism Homo sapiens
molecule keywords BA.4/5-9 light chain
total genus 27
structure length 165
sequence length 215
chains with identical sequence H
ec nomenclature
pdb deposition date 2023-10-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...