8R2GA

Crystal structure of a brca2-dmc1 complex
Total Genus 85

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
254
structure length
239
Chain Sequence
GFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGD

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTII3 (213-216)AH2 (106-112)S2 (116-117)TI'1 (112-115)TII2 (147-150)AH3 (132-143)S4 (155-160)AH4 (167-177)TI1 (160-163)AH6 (196-212)S5 (188-192)S6 (217-223)AH7 (227-232)TIV2 (222-225)AH8 (238-260)AH1 (88-96)TII4 (235-238)TIV1 (117-120)S3 (120-126)AH5 (181-187)TIV3 (224-227)S1 (100-101)TII1 (127-130)Updating...
connected with : NaN
molecule tags Recombination
source organism Homo sapiens
publication title Crystal structure of a BRCA2-DMC1 complex
rcsb
molecule keywords Meiotic recombination protein DMC1/LIM15 homolog
total genus 85
structure length 239
sequence length 254
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2023-11-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.