8R2ME

Mycobacterium smegnatis rna polymerase transcription initiation complex with sigmaa, rbpa, held n-terminal domain and an upstream-fork promoter fragment; state iii conformation
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
84
structure length
78
Chain Sequence
SAYDTPLGITNPPIDELLSRASSKYALVIYAAKRARQINDYYNQEYVGPLVEPGLQEKPLSIALREIHGDLLEHTEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mycobacterial HelD connects RNA polymerase recycling with transcription initiation.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase subunit alpha
molecule tags Transcription
source organism Mycolicibacterium smegmatis mc2 155
total genus 20
structure length 78
sequence length 84
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2023-11-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...