8R4DB

Focused map on the roc-cor domains of the roco protein from c. tepidum in the gtp state bound to the activating nanobody nbroco1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
107
structure length
107
Chain Sequence
QAGGSLRLSCANSGLTFSTYTMGWFRQAPGKEREFVAAIRWSGTSTYYQDHADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAASRLRAGVKAPSEYDYWGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights in the GTP-driven monomerization and activation of a bacterial LRRK2 homologue using allosteric nanobodies
doi rcsb
molecule tags Hydrolase
source organism Chlorobaculum tepidum
molecule keywords Rab family protein
total genus 11
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2023-11-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...