8R5OE

Plastid-encoded rna polymerase
Total Genus 232
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
232
sequence length
1365
structure length
912
Chain Sequence
ANLVFHNKVIDGTAIKRLISRLIDHFGMAYTSHILDQVKTLGFQQATATSISLGIDDLLTIPSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEIWYATSEYLRQEMNPNFRMTDPFNPVHMMSFSGARGNASQVHQLVGMRGLMSDPQGQMIDLPIQSNLREGLSLTEYIISCYGARKGVVDTAVRTSDAGYLTRRLVEVVQHIVVRRTDCGTIRGISVSFIQTLIGRVLADDIYIGSRCVAFRNQDLGIGLVNRFITFGTQSISIRTPFTCRSTSWICRLCYGRSPTHGDLVELGEAVGIIAGQSIGEPGAEHVRAPYNGKIKFNEDLVHPTRTRHGHPAFLCYIDLSVIIESEDIIHSVTIPPKSFLLVQNDQYVESEQVIAEIRERVRKYIYSDSEGEMHWSTDVSHAPEFTYSNVHLLPKTSHLWILSGGILFSIHKDQDQMNIPFSDLLAKRRRNRFLIPISVEIPINGIFRRNSIFAFTLFPKDLFREKDNIQLRLVLNWVRAFFVEVNTKGLIRDFIRIGLRKRNNPMNPFYHGTIRMFSLLILSSSNCFRIGTIKNSSGPLGTAIQISNFYSFLPLLTYNQISVIKYLQLDNFKYIFQVIHSYLIDENGRIFNLDPYSNLVLNPFKLNWYFLHQNYNTIISLGQFFCENVCIAKKEPYLKSGQVLIVQRDSVVIRSAKPYLATPGAKVHGHYREILYEGDTLVTFIYEGLPKVEQVLEVSLNLEKRIKGWNRCITRILGIPWGFLIGAELTIVQSRISLVNKIQKVYRSQGVQIHNRHIEIIVRQITSKVLVSEEGMSNVFLPGELIGLLRAERTGRALEEAICYRAVLLGITRASLNTQSFISEASFQETARVLAKAALRGRIDWLKGLKENVVLGGVIPAGTGFNKGDILFYHREFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the plant plastid-encoded RNA polymerase.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase subunit alpha
molecule tags Gene regulation
total genus 232
structure length 912
sequence length 1365
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2023-11-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...