8R5YA

Structure of coxsackievirus b5 capsid (mutant cvb5f.cas.genogroupb) - a particle
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
203
Chain Sequence
RSESTVENFLCRSACVYYTTYKNHDNFAQWVINTRQVAQLRRKLEMFTYARFDLELTFVITSSQPVLTHQIMYVPPGGPVPTKINSYSWQTSTNPSVFWTEGSAPPRISIPFISIGNAYSMFYDGWARFDKQGTYGINTLNNMGTLYMRHVNPIVSTVRIYFKPKHVKTWVPRPPRLCQYQKAGNVNFEPSGVTEGRTEITAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Influence of Amino Acid Substitutions in Capsid Proteins of Coxsackievirus B5 on Free Chlorine and Thermal Inactivation.
pubmed doi rcsb
molecule tags Virus
source organism Coxsackievirus b5
molecule keywords Coxsackievirus B5 (mutant CVB5F.cas.genogroupB) in particle A state - VP1
total genus 43
structure length 203
sequence length 222
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2023-11-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...