8R9RA

Gdp-bound state of s. putrefaciens flhf
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
255
structure length
255
Chain Sequence
DPVGAMLESKLLEAEFSPAVAAKLAALSQHYTPAELVRALPQSLANMLDNQGDDIVRQGGVVALVGPTGVGKTTSLAKLAARFAAHHGPEQVALITTDHYRIGAYEQLATYGKIMGCPVKQAHDLNELEQILYQFRNRKLVLIDTAGMGQRDMRLYQQLDNLTANSRIPIRSYLVLSATGQRRVLQDAVNHFKRIPLSGAVLTKLDESVSLAGALSVLIQSGLPLSYVTDGQRVPEDMKVADTLMLAQQALATLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the GDP-bound state of the SRP GTPase FlhF.
pubmed doi rcsb
molecule tags Signaling protein
source organism Shewanella putrefaciens
molecule keywords Flagellar biosynthesis protein FlhF
total genus 90
structure length 255
sequence length 255
ec nomenclature ec ?:
pdb deposition date 2023-11-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...