8RB5A

Structure of the three-fold capsomer of the pnma2 capsid
Total Genus 61
204060801001201401600102030405060
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
180
structure length
180
Chain Sequence
LLPVKYCKMRIFSGSTAAAPEEEPFEVWLEQATEIAKEWPIPEAEKKRWVAESLRGPALDLMHIVQADNPSISVGECLEAFKQVFGSTESRRTSQVKYLRTYQQEGEKISAYVLRLETLLRRAVEKRAIPRNIADQVRLEQVMAGANLGNVLWCRLQELKDQGPLPTFLQLMKVIREEEE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Virus like particle
source organism Mus musculus
publication title PNMA2 forms immunogenic non-enveloped virus-like capsids associated with paraneoplastic neurological syndrome.
pubmed doi rcsb
molecule keywords Paraneoplastic antigen Ma2 homolog
total genus 61
structure length 180
sequence length 180
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2023-12-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.