8RDSA

Cereblon isoform 4 from magnetospirillum gryphiswaldense in complex with spiro-isoxazol based compound 8i
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
99
Chain Sequence
SIFRCRQCGQTISRRDWLLPDHEHVVFNPAGMIFRVWCFSLAQGLRLIGAPSGEFSWFKGYDWTIALCGQCGSHLGWHYEGGSQPQTFFGLIKDRLAEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery and characterization of potent spiro-isoxazole-based cereblon ligands with a novel binding mode.
pubmed doi rcsb
molecule keywords Cereblon isoform 4
molecule tags Signaling protein
source organism Magnetospirillum gryphiswaldense
total genus 21
structure length 99
sequence length 102
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2023-12-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...